SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023511 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023511
Domain Number 1 Region: 632-889
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-55
Family YWTD domain 0.00000325
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-55
Family YWTD domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 331-570
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 4 Region: 937-1196
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-39
Family YWTD domain 0.000042
Further Details:      
 
Domain Number 5 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1328-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000115
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1249-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1290-1326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000718
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1206-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000221
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023511   Gene: ENSOCUG00000003006   Transcript: ENSOCUT00000025955
Sequence length 1616
Comment pep:novel chromosome:oryCun2:8:27483831:27629548:1 gene:ENSOCUG00000003006 transcript:ENSOCUT00000025955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSNAFSSFFTYISLSLVLAAPLLLYANRRDLRLVDATNGRENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTE
IYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVDGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLEIGLNREVIADDLPHPFGL
TQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNG
HCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDII
LPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYD
LSIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPERGYMYFTNLQE
RSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIV
LEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELN
LQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPIHLVLLQDELSCGEEPPTCSPQQFTCF
TGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKS
DEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSV
IGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLP
GMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSH
YTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYT
SDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences 9986.ENSOCUP00000023511 ENSOCUP00000023511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]