SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023911 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023911
Domain Number 1 Region: 521-552,635-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000863
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023911   Gene: ENSOCUG00000001129   Transcript: ENSOCUT00000031844
Sequence length 792
Comment pep:known chromosome:oryCun2:7:44294907:44330020:-1 gene:ENSOCUG00000001129 transcript:ENSOCUT00000031844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEPIGNQYVVARPVYSANAFAEEHKKKDRHHKTLLDHLKLCCRCSSRKVKEIVFSLLPI
ASWLPEYKLKEWLLSDIVSGISTGLVAVLQGLAFALLVNIPPAYGLYAAFFPVIVYFFFG
TSKHISVGPFPVLSMMVGAAVVRLAPDDSISTDPSNNSTDDSLTNKRIMVAASVTFLTGI
IQLAFGILRIGFVVIYLSEALISAFTTAAALHVVISQLKFMLQLTVPAHTDPFSIFKVLE
SLFTQIRKTNIADLVTSVIIVVIVFVFKEINERFKAKLPVPIPIELIVTVIAAGLSYGCN
FQQRFNVSVIGKMEKGFQAPAAPDTQVFQDAIGDCFTIAIVGFVVAFSVASVYSLKYDYR
IDGSQELIAFGLGNIVTGSFKGFAGSTALSRSAVQESTGGKTQVAGILSSVIVLIVIVAI
GFLLEPLQKSVLSALALGNLKGMLMQFAEIGRLWKKDKYDCLIWIMTFIFAIVLGLGLGL
AASVAFELLTIVFRTQFPKCTTLANIGRSNIYKNRKDYSDMYEPEGVKIFRCPAPIYFAN
IGFFKQKLIDAIGFSPLRILRKRNKALKKIRKLQKRGLLQVTPKGFICTADGVKDSDDEE
LDNNQIEELDQPIDTTDLPFQIDWNADLPLNITVPKISLHSLILDFSAVSFLDVSSMRGL
KSILKDFVRIKVDVYIVGTDDDFIEKLSRCQFFDDEVKDSIFFLTIHDAVLHILMKKDYS
ASKFNPYQEKEDKFDFTINTNGGLRNREYQVMFSXIKNTIQKTPSFQVSREEQLYTHTVI
ENFIRCMKNIFI
Download sequence
Identical sequences G1TPL4
9986.ENSOCUP00000018950 ENSOCUP00000023911 ENSOCUP00000018950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]