SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025332 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025332
Domain Number 1 Region: 144-197
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-17
Family Fibronectin type II module 0.0013
Further Details:      
 
Domain Number 2 Region: 110-152
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000148
Family Fibronectin type II module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025332   Gene: ENSOCUG00000022777   Transcript: ENSOCUT00000028822
Sequence length 198
Comment pep:known scaffold:oryCun2:GL019267:79193:82313:1 gene:ENSOCUG00000022777 transcript:ENSOCUT00000028822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMAVCWGLCLMWVCAWAFLQMDCVNAAPGLLSELLGLVDDSVVIATPGAESYKAKTIKAS
KITTTTPAATTATHKPTTSQIQNKPPPGLSSTPNAKNALSPGPPGQSDKKCVFPFTFGNK
KHFDCTVEGSIFHWCSLTDKYSGKWKYCTDDDRARCVFPFIFEGHVYKDCITKGSLFRMA
WCSLSPYYDHDKAWKYCY
Download sequence
Identical sequences G1U2M8
9986.ENSOCUP00000023628 ENSOCUP00000023628 ENSOCUP00000025332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]