SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005235 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005235
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 34-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000085
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005235   Gene: ENSOGAG00000005851   Transcript: ENSOGAT00000005853
Sequence length 264
Comment pep:novel scaffold:OtoGar3:GL873682.1:1090963:1113954:-1 gene:ENSOGAG00000005851 transcript:ENSOGAT00000005853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALWMALCALARLWPGALAGCSEAGRCCPGRDPSCFARGWRLDRVYGTCFCDQACRLTG
DCCFDYDRACPARPCFVGEWSPWSGCADECKPTSRVRRRSVRQEPQNGGAPCPPLEERAG
CLEYSTPQGRDCAHAFVPAFITTSAFNKERTRRAASPQWSTHTEDAGYCMEFKTESLTPH
CALENRPLTRWMQYLREGYTVCVDCQPPAMNAVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRKVDQCSCPAVHSFIFI
Download sequence
Identical sequences H0WSZ4
XP_003800084.1.62490 ENSOGAP00000005235 ENSOGAP00000005235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]