SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017353 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017353
Domain Number 1 Region: 82-130
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000123
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 2 Region: 49-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000654
Family Somatomedin B domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017353   Gene: ENSOGAG00000029920   Transcript: ENSOGAT00000029669
Sequence length 273
Comment pep:novel scaffold:OtoGar3:GL873542.1:10853483:10873097:1 gene:ENSOGAG00000029920 transcript:ENSOGAT00000029669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPVLSLALVLDAMAWEQGPPGVISPWRGCAELGRCCPDRDPMCFARGPPRCFCDEACGAA
RDCCADYTRVCPADYTRVCPAVSCVVAEWSGWSRCVKPCQVSYRVRQRHVLQEPRNGGIP
CPPLEERAGCVEYWSCQGVECQQSLLPALITTGSYGKEREKSERSQQQWRRTELLTYCIQ
FRLGFIPGSCGQVKARHAQWTRYLSQGHMVCVKCEWPAQDARSQRCYGDGGGARGNKLLL
WQAAGHPRCQGTWERLGPLRDCSCPTVHSFVFI
Download sequence
Identical sequences H0XML2
ENSOGAP00000017353 ENSOGAP00000017353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]