SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000020730 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000020730
Domain Number 1 Region: 722-779
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000459
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 28-69
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000693
Family Somatomedin B domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000020730   Gene: ENSOGAG00000032910   Transcript: ENSOGAT00000025696
Sequence length 814
Comment pep:novel scaffold:OtoGar3:GL873811.1:894285:900750:1 gene:ENSOGAG00000032910 transcript:ENSOGAT00000025696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLALLSWALLLRVTAPGWGPGPTADAQDSCSMRCGHPEGPCSCHPTCSGLGTCCSDFRD
FCLEISPYSGSLMGGKDFVVQHFKWFSPTEGVICRFKESIQTLGHVDSSGQVHCVSPLLY
ESGRIPFTVSLDNGRSFPRSGTWLAVHPNKVSMDEKGHLVNETRWQYYGTKDTTGNLSVT
WNASALPTQQVTIELWGYEETGAPYSGEWTAKWSYLYPLATNVPNSGFFTFTPKPAPHNY
QAWEVGALRIVNSKSYAGQKDVQALWTNDHALAWHLGYDFREDPVAWARTQCLAWEKLED
QLPDFLGELPDCPCTLAQARADSGRFHTDYGCDMEQGSECTYHPGAVHCVRSVQASPRYG
AGQQCCYMADGTQLLTADSSSGSTPDRGHDWGAPPYRTPPRVPGMSHWLYDVLSFYYCCL
WAPDCPRYMARRPSNDCRTYRPPHLASAFGDPHFVTFDGTKFTFNGRGEYVLLEAALTDL
RVQARAQPRATSNGTQIRGTGLTAVAVQEGNSDVVEVRLADRAGVLEVLLNQEVLSFTEQ
SWMDLKGLFLSVAARDRVSVMLASGAGLEVSVQGPFLSVSVLLPAKFLTHTHGLLGTLNN
DPTDDFTLRSGQVLPPSSSPRDLFHFGANWAVQNTSSLLTYDSWFLRNNFLYQPKHDPTF
EPLFPGEATLSPSQADEAAELCGDDQFCNFDVAATGSLSTGNATRLAHQLHQHRVQSLQP
VVSCGWLAAPQNGRKDSIRYLEGSTIYFHCNNGYSLVGAETSTCRADGRWSAPTPVCQPG
RSYGVLLGIIFGGLALVAAILLTYVLLRRRKDNS
Download sequence
Identical sequences H0XX87
ENSOGAP00000020730 ENSOGAP00000020730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]