SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000804 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000804
Domain Number 1 Region: 11-290
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.85e-74
Family TK-like PP module 0.00045
Further Details:      
 
Domain Number 2 Region: 307-479
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.55e-53
Family TK-like Pyr module 0.0021
Further Details:      
 
Domain Number 3 Region: 512-636
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.89e-28
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000804   Gene: ENSOGAG00000000901   Transcript: ENSOGAT00000000901
Sequence length 638
Comment pep:novel scaffold:OtoGar3:GL873768.1:1044668:1088260:1 gene:ENSOGAG00000000901 transcript:ENSOGAT00000000901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMADEARPDSKTVQVLRDMANRLRIHSIRATCASSSGHPTSCSSAAEIMSVLFFHTMRYK
QSDPESPDNDRFILSKGHTSLYLRGADWTEDVDRQETNFLLDLRRLHSLLETMITTLCIQ
RLSFVDVATGWFGQGLGAACGMAYTGKYFDKASYRVFCLMGDGESSEGSVWEALAFASYY
GLDNLVAIFDVNRLGHSGAFPAEHCIEIYKKRCEAFGWNTYVVDGRDVEALCQVFWQATQ
VKNKPTAVVAKTFKGRGMPNVEDAENWYGKPMPKERADAIIKLIESQIQTNRNLVPKPPI
EDSPQISITDIKMTSPPAYKVGDKMATRRACGLALAKLGHANDRVIMLDGDTKNSTFSEM
FKKEHPERFIECFIAEQNMVSVALGCATRDRTIAFASSFAAFLTRAFDQIRMGAISQANI
NLVGSHCGISVGEDGPSQMALEDLAMFRAIPNCTVFYPSDAVSTEHAVYLAANTKSTCSG
LSLCFVETEQAAVIVIWLARAGFEPTTLRVIRHSVNDKVTVISAGVTLHEALAAADDLSK
EDIPIRVIDLFTIKPLDSATIVSSAKATGGRVVTVEDHYPEGGIGEAVCAAVSMEPDILV
HRLAVSGMPRSGKPIELLDVFGISARHIIVAVKCILKN
Download sequence
Identical sequences H0WHG0
ENSOGAP00000000804 ENSOGAP00000000804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]