SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000001430 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000001430
Domain Number 1 Region: 920-1056,1114-1180
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.19e-39
Family Hemopexin-like domain 0.00092
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000111
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000942
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000001430   Gene: ENSOGAG00000001606   Transcript: ENSOGAT00000001608
Sequence length 1180
Comment pep:novel scaffold:OtoGar3:GL873535.1:7762621:7778925:-1 gene:ENSOGAG00000001606 transcript:ENSOGAT00000001608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWKMLPIYLLLLLSIFLVQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTAELSCKGRCFESFERGRECDCDAQCKKYGKCCPDYESFCEEVHKSTPPTSSKTAP
RPPEARPNIKSTTKRSPKSPDKKKTKKVVESEEITEEHSVSENQESSSSSSSSSSSSTIR
KVKSSKNSAANRELQKKPKVKDNKKKRTPKKTPPPEPPAVDEPGSGLDNEDFKPTPTPDA
PTTKSNKVTTSPKSTTAKPTNPKPSLPPNADASEETSLTAKKETTSETKETSITNKQTSA
STKKETTSAKETRNTEKTSAKDLAPTTQVPGKPTPKAETTTKAPATTTPKEPAPTTTKKP
APTTPKEPAPTTTKEPAPTPKEPAPTTTREPPPTTTKEAEPTTPKEPSPTTPKEPAPTTT
REPPPTTTKEPEPTTPKEPAPTTPKEPELTTPKEPAPTTTKEAEPTTPKEPELTSPKEPE
PTTPKKPPPTTPKEPAPTTPEEPAPTTTKEPAPTTPKELAPTTPKEQPSTTPEKPAPTSP
KEPAPTTTKEPEPTTPKEQPSTTPEKPAPTTPKEPAPTTPKEPAPTSPKEPVPTSPKDPA
STTPKEPAPTTPQDPAPTTTREPASTTPETPAPTTSSPSTTTEPPTIPENPPESTPEFPA
EPTPKDLENSPTEPAEPTSKTPEVSKSEMTTPTKDKTTEKDTRPTPEATTAAPKMTTEET
AATKEETTASQTTSTTPRVTSHAAQDATWLRATTPKATTLAPKVTTTAKETTSIAEETAQ
TPEQTAKPTDTPANSKATTPKPRKPTKAPKKPTSTRKPRPRKPKTTPAPPETTTAMPAVN
PISRAETTLQTTVSPKQTPNSLQVEENPRSEDAQGPGGEKPHLIPRPPVLIPIVIPGSDY
IVRRPNQGISFDPMLSDETNLCNGKPVDGLTTLRNGTLVAFRGHYFWMLNPFTPPSPARR
ITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDVKDSGYPKQIVKGFNGLTGKIV
AALSIAKFKNRPESVYFFKRGGSVQQYTYKQEPVRKCPGRRPPINYSVYGDTTQVRRRRF
ERAIGPSQTHTITIHYTPVRVAYQDKGFLHNELKVSTLWRGLPNVVTSAISLPNIRKPDG
YDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP
Download sequence
Identical sequences H0WIZ1
ENSOGAP00000001430 ENSOGAP00000001430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]