SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003066 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003066
Domain Number 1 Region: 17-286
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.75e-82
Family Carbonic anhydrase 0.0000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003066   Gene: ENSOGAG00000003438   Transcript: ENSOGAT00000003441
Sequence length 314
Comment pep:novel scaffold:OtoGar3:GL873613.1:6061030:6069070:-1 gene:ENSOGAG00000003438 transcript:ENSOGAT00000003441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRLLALLVFAAARTSAAAESHWCYEIQAEAPNQLCLGPSNWTGSCQKNRQSPIDIVTSK
AKEDQTLGHFIFSGYDKKEKRNVSNNGHSVEVTLKNDNIEISGGGLPTGYQATQLHLHWS
SEMNAGSEHSIDGKRFAMEMHIVHNKKVTGTSKSAKEAQNTGDDIAVLAFLVKEGPKENE
GFWPLVEALAHIPKPGMDTEMREFSLWDMLPKEEKLRHYFRYQGSLTTPNCDETVVWTVF
QESIELRRDQILVFSQKLWYDAEQRVNMTDNVRPVQRLGDRTVFKSQAPGQLLPLPLPTL
LVPTLTYLAAGFLR
Download sequence
Identical sequences H0WMS5
XP_003795652.1.62490 ENSOGAP00000003066 ENSOGAP00000003066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]