SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000003266 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000003266
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-44
Family G proteins 0.0000221
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000785
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000003266   Gene: ENSOGAG00000003679   Transcript: ENSOGAT00000003681
Sequence length 281
Comment pep:novel scaffold:OtoGar3:GL873563.1:6773241:6812729:1 gene:ENSOGAG00000003679 transcript:ENSOGAT00000003681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLASGAGGGSSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences A0A2K6F820 H0WN84
ENSOGAP00000003266 ENSOGAP00000003266 XP_003790793.1.62490 XP_010949183.1.22495 XP_010989411.1.51371 XP_012515065.1.63892 XP_012593278.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]