SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004335 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004335
Domain Number 1 Region: 434-925
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-163
Family ALDH-like 0.000000000721
Further Details:      
 
Domain Number 2 Region: 23-222
Classification Level Classification E-value
Superfamily Formyltransferase 3.66e-48
Family Formyltransferase 0.0000000182
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.83e-26
Family Post formyltransferase domain 0.0000122
Further Details:      
 
Domain Number 4 Region: 345-432
Classification Level Classification E-value
Superfamily ACP-like 0.000017
Family Acyl-carrier protein (ACP) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004335   Gene: ENSOGAG00000004847   Transcript: ENSOGAT00000004852
Sequence length 926
Comment pep:novel scaffold:OtoGar3:GL873526.1:16512908:16566439:1 gene:ENSOGAG00000004847 transcript:ENSOGAT00000004852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRGSQALRSFSTGRVYFKNKLKLALIGQSVFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLGLAAEKDGTPVFKFPRWRVKGKTIKEVADAYRSVGAELNVLPFCTQFIPMDVIDGP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPVLLQKSCDVQPND
TVDSLYNRFLFPEGIKAMVEAVQLIADGKAPRVPQPEEGVTYEGIQKKENAEISWDQPAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPSGQPLEIKGAKKPGLVTKNGLVL
FGNDGKVLMVRNLQFEDGKMIPASQYFSAGETSVVELTAEEVKVAETIKVIWAGILSNVP
VIEDSTDFFKSGASSMDVVRLVEEIRQKCGGLQLQNEDVYMATKFDDFIQKVVRKLRGED
QEAELAVDYVSKEINEMTVKMPYQCFINGQFTDADDGKTYDTINPTDGSIICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGSIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFHDCELDKAVRMLLKGM
GAVFFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLE
KLLQYCEAGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFP
NGDVDGVLQRANNTEYGLASGVFTKDINKAMYMSEKLEAGTVFINTYNKTDVAAPFGGVK
QSGFGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences H0WQT0
ENSOGAP00000004335 ENSOGAP00000004335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]