SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006920 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006920
Domain Number 1 Region: 632-889
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-55
Family YWTD domain 0.00000325
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-55
Family YWTD domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 331-570
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-49
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 4 Region: 937-1196
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-39
Family YWTD domain 0.0000458
Further Details:      
 
Domain Number 5 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000167
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000662
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 7 Region: 1327-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 1248-1288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1289-1325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000718
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1206-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000032
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006920   Gene: ENSOGAG00000007729   Transcript: ENSOGAT00000007736
Sequence length 1615
Comment pep:novel scaffold:OtoGar3:GL873643.1:828136:975843:-1 gene:ENSOGAG00000007729 transcript:ENSOGAT00000007736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNQYVSFFLLTYFSFFVPAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTE
IYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYEESKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGTNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLEIGLNREVIADDLPHPFGL
TQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNG
HCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDII
LPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSAPNQNLEIQPYD
LSIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQE
RSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIV
LEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELN
LQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFT
GEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSD
EKNCEVLCLIDQFRCANGQCIGKHKKCDHNMDCSDKSDELDCYPTEEPAPQTTNTVGSVI
GVIVTIFVSGTIYFICQRMLCPRMKGDGETMANDYVVHGPASVPLGYVPHPSSLSGSLPG
MSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHY
TMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVTTAKGYTS
DLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences H0WWX8
ENSOGAP00000006920 ENSOGAP00000006920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]