SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007417 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007417
Domain Number 1 Region: 12-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.08e-44
Family G proteins 0.0000157
Further Details:      
 
Domain Number 2 Region: 190-229
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000327
Family SOCS box-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007417   Gene: ENSOGAG00000008284   Transcript: ENSOGAT00000008287
Sequence length 279
Comment pep:novel scaffold:OtoGar3:GL873537.1:462015:480887:1 gene:ENSOGAG00000008284 transcript:ENSOGAT00000008287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLD
GRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGINRWIKEIDEHAPGV
PKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNVTESFTELARTVLLRHG
MDRLWRPSKVLSLQDLCCRVVVSCTPVHLVDKLPLPMALRSHLKSFSMASGLNARMMHGR
SYSLAASTIHKRSSFRKVKVVCPPQSPPKNCTRNGCKIS
Download sequence
Identical sequences H0WY51
ENSOGAP00000007417 ENSOGAP00000007417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]