SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007896 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007896
Domain Number 1 Region: 379-577
Classification Level Classification E-value
Superfamily Kelch motif 9.16e-59
Family Kelch motif 0.0000133
Further Details:      
 
Domain Number 2 Region: 28-147
Classification Level Classification E-value
Superfamily POZ domain 1.69e-35
Family BTB/POZ domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007896   Gene: ENSOGAG00000008804   Transcript: ENSOGAT00000008809
Sequence length 588
Comment pep:novel scaffold:OtoGar3:GL873601.1:8376092:8443824:1 gene:ENSOGAG00000008804 transcript:ENSOGAT00000008809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRPARPAQLRRPGKMVEDGAEELEDLVHFSVSELPSRGYGVMEEIRRQGKLCDVTLKIGD
HKFSAHRIVLAASIPYFHAMFTNDMMECKQDEIVMQGMDPSALEALINFAYNGNLAIDQQ
NVQSLLMGASFLQLQSIKDACCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQH
FVEVSMSEEFLALPLEDVLELVSRDELNVKSEEQVFEAVLAWVRYDREQRGPCLPELLSN
IRLPLCRPQFLSDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRCCTSI
AGLIYAVGGLNSAGDSLNVVEVFDPIANRWEKCHPMTTARSRVGVAVVNGLLYAIGGYDG
QLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLNSVETYSPE
TDKWTVVTPMSSNRSAAGVTVFEGRIYVSGGHDGLQIFNSVEHYNHHTATWHPAASMLNK
RCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRL
YAVGGYDGQSNLSSVEMYDPETDRWTFMAPMACHEGGVGVGCIPLLTI
Download sequence
Identical sequences H0WZ95
ENSOGAP00000007896 ENSOGAP00000007896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]