SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021769 from Otolemur garnettii 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021769
Domain Number 1 Region: 321-378
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.39e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 9-51
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000152
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021769   Gene: ENSOGAG00000005229   Transcript: ENSOGAT00000027611
Sequence length 378
Comment pep:novel scaffold:OtoGar3:GL873539.1:7628071:7662843:-1 gene:ENSOGAG00000005229 transcript:ENSOGAT00000027611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WANCSISYLLPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SEEQQLLLQVQQQHQPQQPQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIV
PDSKLIQHMNASNMNSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIIQPQ
QSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPPQILFTGNKTQVIPTT
VAAPTQAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDFDDDDEEED
KEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIM
NLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences H0Y076
ENSOGAP00000021769 ENSOGAP00000021769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]