SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020278 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020278
Domain Number 1 Region: 70-141
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000161
Family C-type lectin domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020278   Gene: ENSPPYG00000018072   Transcript: ENSPPYT00000021074
Sequence length 142
Comment pep:known chromosome:PPYG2:7:139211845:139230793:-1 gene:ENSPPYG00000018072 transcript:ENSPPYT00000021074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNS
FITTRSYGTKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGL
TKTFDAASCDISYRRICEKNAK
Download sequence
Identical sequences H2PNR2
9600.ENSPPYP00000020278 ENSPPYP00000020278 ENSPPYP00000020278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]