SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004866 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004866
Domain Number 1 Region: 122-269
Classification Level Classification E-value
Superfamily C-type lectin-like 5.25e-34
Family C-type lectin domain 0.00000019
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000004866
Domain Number - Region: 56-147
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0314
Family Fibrinogen coiled-coil and central regions 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004866   Gene: ENSPPYG00000004267   Transcript: ENSPPYT00000005057
Sequence length 273
Comment pep:known chromosome:PPYG2:12:10454157:10470512:-1 gene:ENSPPYG00000004267 transcript:ENSPPYT00000005057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLVAVTLGVLCLGLVVTIMALGMQL
SQVSDLLTQQQANLTHQKNKLEGQISARQQAEEASQESQNELKEMIETLARKLNEKSKEQ
MELHYQNLNLQETLKRVANCSAPCPQDWIWHEENCYLFSSGSFNWEKSQEKCLSLDAKLL
KINNTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPS
GTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Download sequence
Identical sequences H2NGH5
XP_002822951.1.23681 ENSPPYP00000004866 ENSPPYP00000024690 ENSPPYP00000004866 9600.ENSPPYP00000004866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]