SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009081 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009081
Domain Number 1 Region: 169-354
Classification Level Classification E-value
Superfamily E set domains 2.66e-78
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000105
Further Details:      
 
Domain Number 2 Region: 63-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.02e-24
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009081   Gene: ENSPPYG00000008074   Transcript: ENSPPYT00000009450
Sequence length 420
Comment pep:novel chromosome:PPYG2:17:20690880:20692142:1 gene:ENSPPYG00000008074 transcript:ENSPPYT00000009450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVAHGDLEPAEGRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPXXXXXXXX
XXXXXXXXXXXXRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGALEQRPYRRESEI
Download sequence
Identical sequences H2NT14
ENSPPYP00000009081 ENSPPYP00000009081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]