SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009701 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009701
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-29
Family GRAM domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009701   Gene: ENSPPYG00000008640   Transcript: ENSPPYT00000010087
Sequence length 261
Comment pep:known chromosome:PPYG2:17:65875021:65885267:-1 gene:ENSPPYG00000008640 transcript:ENSPPYT00000010087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFL
SKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAI
EFGQRMLQVASQASRGEVPSGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFY
PGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNV
YMPTSQPPPPPYYPPEDKKTQ
Download sequence
Identical sequences A0A024R8L1 G2HIQ3 G3R1G1 H2NUR2 Q969T9
ENSP00000254806 ENSP00000467579 ENSGGOP00000009030 9600.ENSPPYP00000009701 9606.ENSP00000254806 ENSPPYP00000009701 NP_001267430.1.37143 NP_036610.2.87134 NP_036610.2.92137 XP_003813321.1.60992 XP_004041064.1.27298 XP_009250323.1.23681 ENSP00000254806 ENSP00000467579 4586 ENSPPYP00000009701 gi|24430132|ref|NP_036610.2| ENSGGOP00000009030 ENSP00000254806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]