SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009919 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009919
Domain Number 1 Region: 4-434
Classification Level Classification E-value
Superfamily ALDH-like 1.13e-134
Family ALDH-like 0.00000000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009919   Gene: ENSPPYG00000008841   Transcript: ENSPPYT00000010318
Sequence length 453
Comment pep:known chromosome:PPYG2:17_random:7479370:7487295:-1 gene:ENSPPYG00000008841 transcript:ENSPPYT00000010318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALRRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYMLCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPLLPIVCVRSLEEAIQFINQREK
PLALYVFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEALKVRYPPSPAKMTWH
Download sequence
Identical sequences H2NVB9
9600.ENSPPYP00000009919 ENSPPYP00000009919 ENSPPYP00000009919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]