SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014367 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014367
Domain Number 1 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-34
Family C-type lectin domain 0.00078
Further Details:      
 
Domain Number 2 Region: 350-487
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-33
Family C-type lectin domain 0.00069
Further Details:      
 
Domain Number 3 Region: 1372-1515
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-28
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 4 Region: 949-1092
Classification Level Classification E-value
Superfamily C-type lectin-like 3.65e-27
Family C-type lectin domain 0.0044
Further Details:      
 
Domain Number 5 Region: 1534-1662
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-27
Family C-type lectin domain 0.0007
Further Details:      
 
Domain Number 6 Region: 1107-1223
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-26
Family C-type lectin domain 0.00081
Further Details:      
 
Domain Number 7 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.01e-25
Family Cysteine rich domain 0.009
Further Details:      
 
Domain Number 8 Region: 634-792
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-25
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 9 Region: 1239-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-18
Family C-type lectin domain 0.0049
Further Details:      
 
Domain Number 10 Region: 501-625
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-18
Family C-type lectin domain 0.0025
Further Details:      
 
Domain Number 11 Region: 818-932
Classification Level Classification E-value
Superfamily C-type lectin-like 8.1e-16
Family C-type lectin domain 0.023
Further Details:      
 
Domain Number 12 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000117
Family Fibronectin type II module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014367   Gene: ENSPPYG00000012874   Transcript: ENSPPYT00000014952
Sequence length 1722
Comment pep:known chromosome:PPYG2:2b:49551371:49665569:-1 gene:ENSPPYG00000012874 transcript:ENSPPYT00000014952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTGWATPRPPAGLLMLLFWFFDLAESSGRAANDPFTIVHGNTGKCIKPVYGWIVAEDCD
ETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNEVRMFSCDSSAMLWWKCEHHSLYGAAQ
YRLALKNGHGTAISNASDVWKKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLIGGTWH
HDCILDEDHSGPWCATTLNYEYDRKWGICLKPENGCEDNWEKNEQFGSCYQFNTQTALSW
KEAYVSCQNQGADLLSINSAAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTR
CDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFNSDLISIHSLADVEVVVTKLHNEDIKEE
VWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEK
LKYVCKRKGERLNDTSSDKMCPPDEGWKRRGETCYKIYKDEVPFGTNCNLTITSRFEQEY
LNDLMKKYDKSLRKYFWTGLRDVDSRGEYNWATVGGRRRAVTFSNWNFLEPASPGGCVAM
STGKSIGKWEVKDCRSFKALSICKKISGPLEPEEAAPKPDDPCPEGWQSFPASLSCYKVF
HAERIVRKRNWEEAERFCQALGAHLSSFSHVDEIKEFLHFLTDQFSGQRWLWIGLNKRSP
DLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWLFYDDREFIYLRPF
ACDTKLEWVCQIPKGRTPKTPDWYNPERAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYC
ASNHSFLATITSFVGLKAIKNKIANISGDGQKWWIRISEQPIDDHFTYSRYPWHRFPMTF
GEECLYMSAKTWLIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSGQWIPFQN
KCFLKIKPVSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYE
KINKWTDNRELTYSNFHPLLVSRRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSC
SERHFVSLCQKYSEVKGRQTLQNASETVKYLNNLYKIIPKTLTWHSAKRECLKSNMQLVS
ITDPYQQAFLSVQALLQNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAETNGQLEDCVVL
DIDGFWKTVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFII
TKNRHMATTQEEVHSKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYGN
NSLMWFDKTPLSYTHWRAGRPTIKNEKFLAGLSTDGFWDIQTFKVTEETLYFHQHSILAC
KIEVVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHNQNGQLF
LEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPGNCVLLDPKGTWKHE
KCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWIQYKGHCYKSDQALHSFSEAK
KLCSKHDHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQSWSWLDGSEVT
FVKWENKSKSGVGKCSMLIASNETWKKVECEHGFGRVVCKVPLGPDYTAIAIIVATLSIL
VLMGGLIWFLFQRHRLHLAGFSSVRYAQGVNEDEIMLPSFHD
Download sequence
Identical sequences H2P7M2
ENSPPYP00000014367 ENSPPYP00000014367 9600.ENSPPYP00000014367 XP_002812561.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]