SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015043 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015043
Domain Number 1 Region: 86-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.47e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000486
Further Details:      
 
Domain Number 2 Region: 446-565
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.72e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000122
Further Details:      
 
Domain Number 3 Region: 2-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.81e-24
Family Thioltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015043   Gene: ENSPPYG00000013449   Transcript: ENSPPYT00000015644
Sequence length 569
Comment pep:known chromosome:PPYG2:3:6144429:6191553:1 gene:ENSPPYG00000013449 transcript:ENSPPYT00000015644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRVVIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTVPNIFV
NKVHVGGCDQTFQAYQSGLLQKLLQEDSAYDYDLIIIGGGSGGLSCAKEAAILGKKVMVL
DFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRHNWETM
TKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQFVIAT
GERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDVTVMVR
SILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSSEGTETIE
EVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDILEDKPE
LTPVAIQSGKLLARRLFGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKKENLEI
YHTLFWPLEWTVAGRENNTCYAKIICNKIRSDRVIGFHILGPNAGEVTQGLAAAMKCGLT
KQLLDDTIGIHPTCGEVFTTLEITKSSGL
Download sequence
Identical sequences H2P9G6
ENSPPYP00000015043 ENSPPYP00000015043 9600.ENSPPYP00000015043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]