SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015077 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015077
Domain Number 1 Region: 536-728
Classification Level Classification E-value
Superfamily Macro domain-like 1.01e-52
Family Macro domain 0.0000691
Further Details:      
 
Domain Number 2 Region: 945-1145
Classification Level Classification E-value
Superfamily Macro domain-like 1.14e-45
Family Macro domain 0.00079
Further Details:      
 
Domain Number 3 Region: 759-935
Classification Level Classification E-value
Superfamily Macro domain-like 2.19e-41
Family Macro domain 0.00017
Further Details:      
 
Domain Number 4 Region: 1368-1547
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.07e-40
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.026
Further Details:      
 
Domain Number 5 Region: 1239-1348
Classification Level Classification E-value
Superfamily WWE domain 7.98e-21
Family WWE domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015077   Gene: ENSPPYG00000013479   Transcript: ENSPPYT00000015679
Sequence length 1548
Comment pep:novel chromosome:PPYG2:3:9952479:10000070:-1 gene:ENSPPYG00000013479 transcript:ENSPPYT00000015679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGRVANVEFFPEESSALIEFFDRKVLDTIMATKLDFNKMPLSVFPYYASLGTALYGKEK
PLIKLPAPFEESLDLPLWKFLQKKNHLIEEINDEMRRCHCELTWSQLSGKVTIRPAATLV
NEGRPRIKTWQADTSTTLSSIRSKYKVTPIKVDPTMWDTIKNDVKDDRILVEFDTLKEMV
ILAGKSEDIQGIEVQVRELIESTTQKIKREEQSLKEKMVISPGRYFLLCHSSLLDHLRTE
CPEIEICYDGVTQHLCLKGPSADVYKVKCEIQEKVYTMAQKNIQVSPEIFQFLQQVNWKE
FSKCLFIAQKILALYELEGTTVLLTSCSSEALLEAEKQMLSALNYKHIEVENKEVLHGKK
WKGLTHNLLKKQNSSPNTVIINELTSETTAEVIITGCVKEVNETYKLLFNFIEQNMKIER
LVEVKPSLVIDYLKTEKKLFWPKIKKVNVQVSFNPENKQKGILLTGSKTEVLKAVDIVKQ
VWDSVCVKSVHIDKPGAKQFFQDKARFYQSEIKRLFGCYIELQENEEMMEEGSPVGQKCF
SRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIV
KREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKY
RSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEA
VKTVFKATLPDTAAPPSLPPAAVGPGKTSWEKGSLVSPGGLQMLLVKEGVQNAKTDVVVN
SVPSDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSVGAVLKTSSWNLDCRYVLHVV
APEWRNGSISSHKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFPKTIFAELIISEVF
KFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRANGNLVSDKIPKAKDTQGFYGTVS
SPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQSVERE
CSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGT
GSAKQDPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREGTQVSS
QQSVMSKLASFLGFSKQSPKKKNNLVLEKKTESATFRVCGENVTCVEHAISWLQDLIEKE
QCPYTSEDECIKDFDEKEYQELNELQKKLNINISLDHKRPLIKVLGISRDVMQARDEIEA
MIKRVRLAKEQESRADCISEFIEWQYNDNNTFHRFNKMTNLKLEDARREKKKTIDVKINH
RHYTVNLNTYTATDAKGHSLSVQRLTKSKVDIPAHWSDMKQQNLCVVELLPGDPEYNTVA
SKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDASSVPHVN
RNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNH
SLIVPPSKNPQNPTDLYDTVTDNVNHPSLFVVFYDYQAYPEYLITFRK
Download sequence
Identical sequences H2P9J8
ENSPPYP00000015077 ENSPPYP00000015077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]