SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022907 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022907
Domain Number 1 Region: 37-130
Classification Level Classification E-value
Superfamily FKBP-like 4.25e-29
Family FKBP immunophilin/proline isomerase 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022907   Gene: ENSPPYG00000020460   Transcript: ENSPPYT00000023870
Sequence length 131
Comment pep:known chromosome:PPYG2:X:69594650:69617647:1 gene:ENSPPYG00000020460 transcript:ENSPPYT00000023870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKS
GMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKF
GYHIIMVEGRK
Download sequence
Identical sequences H2PW04 Q9Y237
ENSNLEP00000022013 XP_002813636.2.23681 XP_002831846.1.23681 XP_003280920.1.23891 XP_010330700.1.74449 XP_012291037.1.9421 ENSPPYP00000022907 ENSPPYP00000022907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]