SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|TcIL3000.5.620 from Trypanosoma congolense 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TcIL3000.5.620
Domain Number 1 Region: 41-341
Classification Level Classification E-value
Superfamily ApbE-like 4.19e-54
Family ApbE-like 0.0017
Further Details:      
 
Domain Number 2 Region: 370-418
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000000353
Family N-terminal domain of adrenodoxin reductase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|TcIL3000.5.620
Sequence length 418
Comment | organism=Trypanosoma_congolense | product= | location=T.congo.pschr.5:185891-187146(+) | length=418
Sequence
MVDGRSSASVVAVDPERAARERDAAARAILQDSPLHAPMQYATSGVELTVPYTLKVVATS
DAFDRAKEVADEVLRCAWQLADTVLNNFNPSSEVSLVGRLPVGQKHQMSAPLKRVMACCQ
RVYNSSAGCFDPATAPVAKVLRDVALGKKKDAEALGMLEQMCTLPNSFLIDLDAGTISRK
HEHAMLDLGGVSKGYIVDYVVDNINAAGFTNVFFDWGGDCRASGTNARNTPWVVGIVRPP
SLEMLRNPPKEPSYISVISLDNEALATSGDYENLIYMSDDKPCTTTYDWKSKELMKPSQT
NIAQVSVKCYSAMYADALATASFIKRDPAKVRQLLDGWRYVRDTVKDYRLYVRENERVAK
MFEIATEDAEMRKRRISNTLPARVIVVGGGLAGLSAAIEAANCGAQVILMDKEASLGG
Download sequence
Identical sequences G0UMG2
psu|TcIL3000.5.620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]