SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|TcIL3000.11.11710 from Trypanosoma congolense 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TcIL3000.11.11710
Domain Number 1 Region: 7-376
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.74e-107
Family IF2B-like 0.00000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|TcIL3000.11.11710
Sequence length 390
Comment | organism=Trypanosoma_congolense | product= | location=T.congo.pschr.11:3132094-3133266(+) | length=390
Sequence
MTVVCKDTLESIKYSRGKLQLLDQRRLPLETVYVNITSVDDICHAIKEMQVRGAPAIAVS
AALAIAVVAEREHRQRQTSTWETAAEVRQFLMESCVKIMAARPTAVNLSKVLLQLMQDIE
AIKADSANTVVDACVQLAEKIYAADVAFNESIMQHGASHFMKITPKKKLNVLTICNTGAL
ATSRYGTALGVVRQLFYDGHLQQLYACETRPWNQGARLTVYECVQENIPCTLICDSAVSS
LMGTHAVDVVVVGADRICRNGDTANKIGTYNVAVAAAYHKVPFFVAAPSTTLDPLTANGG
GVTIEEREPTEITHVTITNCDGAQGEASAREPVRRRVVTDGPNLRIWNPVFDITPASLIT
GGIITERGVVTPSAMEPFYDIEHLLAVQSS
Download sequence
Identical sequences G0V207
psu|TcIL3000.11.11710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]