SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|TcIL3000.11.15420 from Trypanosoma congolense 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TcIL3000.11.15420
Domain Number 1 Region: 152-335
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.63e-21
Family Deoxycytidylate deaminase-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|TcIL3000.11.15420
Sequence length 362
Comment | organism=Trypanosoma_congolense | product= | location=T.congo.pschr.11:4341144-4342232(-) | length=362
Sequence
MEEVVVPEEPPKLVRAYATCIQPQRWCTVFLRIANKSFPLGPSGCHLKRIRRTPISQGTS
VINTEDTQCVIHNRQGNDSTSIGGADEGVATGAAASAETHKLELLLSVGDAVDPGMLKEF
EFSSDCPAVTVHAVWVPDRAPRTSPEEWSKWCHIWPFSTPKPRQPTKLASSELAHIRCIF
STVVMPLARRTHTAETLGIAAALVDPSKGGCVAATSEGAYPLRRDNIAACLGYVSCCGKA
SDSGLVIDHPVTFVLKEVSRRCGGCHEASDNVPYLASGMDLFVSHEPCIMCSMALVHSRV
KRVFYCFPNPVHGGLGSTASIHAIPELNHHFQVFRCSAEWLSAADSEDEERCCCSCEDLR
TP
Download sequence
Identical sequences G0V302
psu|TcIL3000.11.15420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]