SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|TcIL3000.9.900 from Trypanosoma congolense 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TcIL3000.9.900
Domain Number 1 Region: 18-162
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.9e-36
Family Cytidine deaminase 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|TcIL3000.9.900
Sequence length 181
Comment | organism=Trypanosoma_congolense | product= | location=T.congo.pschr.9:305278-305823(-) | length=181
Sequence
MAHLLKTNTLLPVSQLTEEEKQLVRSAVDAHRRSYCPYSNFAVGAALLHEDGKITAGCNY
ENCVYKGTCAEACAIVKANAEGYRTARAVAIYGRSVLEAGANTPGDTVVSPCGFCRQLLA
ETADISRNTEDFLIVLVTFDQKHVKLFKLAELLPLSFGPSSIGMDVSALAKGEHTGSAPS
D
Download sequence
Identical sequences G0UTI1
psu|TcIL3000.9.900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]