SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390942342|ref|YP_006406103.1| from Belliella baltica DSM 15883

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390942342|ref|YP_006406103.1|
Domain Number 1 Region: 123-276
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.49e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 398-560
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-29
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 20-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.93e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0068
Further Details:      
 
Domain Number 4 Region: 258-281,311-412
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.42e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390942342|ref|YP_006406103.1|
Sequence length 700
Comment sulfite reductase subunit beta (hemoprotein) [Belliella baltica DSM 15883]
Sequence
MQSFRTEIENPVVEKDIIELERKIALFKEGKIDDEKFRSLRLARGIYGQRQQGVQMIRIK
LPYGRVTSEQLHRISQVSDKYSTGRLHITTRQDIQIHYVKIDQTPELWAELEKDDVTIRE
ACGNTVRNVTASEMAGIDPNEPFDVTPYAEATFQYFLRNPISQEMGRKFKIAFSSSDEDT
ALAYLHDIGVIPKVKEENGEQIRGFKILLGGGLGSQPRHADAVYEFLPTDKLIPFIESVI
RIFDRYGERAKRMKARMKFLVKDLGLETFLDLVKEEELSLPFKTYPIEYKAYEASQIQPS
PEIIQVEEPAELAYEQWKLTNIIPQKQSGFVAIGIKVKLGDFYTDKARLLADLVKKYANN
ELRFTLRQNILIRDVKEELIPFFYQELKKLGFVDRGYNTFGDITACPGTDTCNLGIASST
GAAGVLEDVIFNEYPQYLSNKDLTIKISGCMNACGQHNMASIGFQGMSIKAGKHVLPALQ
VLLGGGTLGNGEGRFADKVIKIPSKRGPQALRILLDDFEANAFETENFLAYYDRQGQMYF
YELLKETANIEDVVESDFVDWGNNDPYVKEIGVGECAGVIIDLVSTLLLEAREKIANAEE
SLESGAWSDAIYHTYAGLVNTAKAILLAEGVNTNSHASILKQYDEQFTETGKIDLKDSIE
NITYQIKSNEPTEAFAKAYFATAQQVFETISNYRAKEVSA
Download sequence
Identical sequences I3Z280
WP_014771357.1.36456 gi|390942342|ref|YP_006406103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]