SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390943527|ref|YP_006407288.1| from Belliella baltica DSM 15883

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390943527|ref|YP_006407288.1|
Domain Number 1 Region: 12-194
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.29e-22
Family Crotonase-like 0.056
Further Details:      
 
Domain Number 2 Region: 384-451
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000471
Family NfeD domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390943527|ref|YP_006407288.1|
Sequence length 453
Comment membrane-bound serine protease [Belliella baltica DSM 15883]
Sequence
MKNILTLTFLLFFLVLNSAYSKQDSLQNVKKKVYTFEIKSDIDPRMNRKVKLALEEAESK
EADLIIIEMDTYGGAVNDADDIRTMVLETQVPIHVWINKDAASAGALISIACDSIYMAPG
SSIGAATVVMGGGGEAAPDKYQSYMRSMMRSTAEAKGRDPKIAEAMVDQNLEVEGISEKG
SVITFSVSEAIANGFSEGEVISLTEVIEKQGIESFEIIKYTESNVEKVISIFLNPAVSGF
LILIIFAGIYFEIQTPGVGFPIAASVIAIILYFIPYYLTGLAQNWEIAVFVVGVILLLIE
LFVIPGFGIFGILGIIGILTGLTLGMIPNDAFDFTFVPSGDLFVALLTVILAAIVAMALI
FFFAPKINQWKAFSTIALATTQQRSEGYTSTSYQNDLLGKGGIAHTRLMPSGKILLEDEV
YDAYSRGEFIDKGEKVIVISTEGTSLKVKKVSS
Download sequence
Identical sequences I3Z5L5
gi|390943527|ref|YP_006407288.1| WP_014772511.1.36456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]