SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390944857|ref|YP_006408618.1| from Belliella baltica DSM 15883

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390944857|ref|YP_006408618.1|
Domain Number 1 Region: 44-107
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|390944857|ref|YP_006408618.1|
Sequence length 257
Comment hypothetical protein Belba_3359 [Belliella baltica DSM 15883]
Sequence
MSQIKDSIKKVGIHIGIILGIIILLSFTFLKIFLPSYTNHGETVSVPDVTGFDFEEVESF
LSTRDLKYEINIDSGFNSDLKPFTVLKQNPKPGNKVKSGRKIYLTLNSKNAPLLKMPNLV
NSPLKNVQEILSNIGLVRGEIKYVPDIGINVVLEQKYRGRNIPEGFEIPKGSQIDLVVGD
GLGNQILDVPNLIGMDEIDAEFLIIGSGLRMGRINYVTTDTVPQGTIVQHLPPAGAEVKT
GEPIDLWISEIAKQRDF
Download sequence
Identical sequences I3Z9E5
gi|390944857|ref|YP_006408618.1| WP_014773800.1.36456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]