SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TEQG_00012T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_00012T0
Domain Number 1 Region: 139-450
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.17e-54
Family Glutamine synthetase catalytic domain 0.0012
Further Details:      
 
Weak hits

Sequence:  TEQG_00012T0
Domain Number - Region: 37-126
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0968
Family Glutamine synthetase, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TEQG_00012T0
Sequence length 455
Sequence
MAPHANRAKVDDAKANSMAGTEGSNALHALLTLYPSICFLRCQWQDYSGVVRARIVPMEH
AQAIAAEKRRLHVPACAFHLTVSHENIPEMDPRGYHWLIPDWDSLYPASQQLGVDPSYAS
VMCGVVEHLPIRPELNWNYCPRRALKTVVEKAEKLLHVHFLVGFEVEFQVMKAEADGKIG
PHSSGLGRCAISGLRDPCVAHIQEVVHILIKAGVGVGAFQTEGDRGQYEIALEPQSPIRA
IDELIFVHDTLKSVFARHGLIATMAPRPVASHKQVAGQHTHISLNPPNKETSFLAGILRR
LPGLCAFFLPYDLSYERVQPYLAGHIVAWGSENRAVPVRQIKPGHWELRCVDATANMYVA
LAAVISAGTIGCINEEPLVWPDTGLITEHFPTSGVEPFPKSVAGSLEQLEKACDSLQEFM
ESRILRHYIAVKRYEAPRLQTLPEETVRQLLCEIF
Download sequence
Identical sequences F2PGD9
TEQG_00012T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]