SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TEQG_01107T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_01107T0
Domain Number 1 Region: 108-352
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 3.78e-73
Family Glutamine synthetase catalytic domain 0.0049
Further Details:      
 
Domain Number 2 Region: 19-105
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 5.62e-21
Family Glutamine synthetase, N-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TEQG_01107T0
Sequence length 356
Sequence
MANTRRSDAANLQKYMGLDQRGKVLAEYVWVDSHGGVRSKTKTLSRPVTSADELPEWNFD
GSSTGQAPGHDSDVYLRPCAIFPDPFRGGDNILVLCETWDSDGSPNKYNYRHEAARLMRT
HEKEQFWFGLEQEYTLLDADGWPFGWPKGGYPGAQGPYYCGVGTGKAQCRDIVDAHYKAC
LYAGISISGINAEVMPSQWEYQVGPCEGITLGDQLWMSRFLLNRVAEDFGVVISFAPKPI
PGDWNGAGLHSNVSTAAMRAEGGMKVIEAAMKKLEARHPEHIAVYGEGNEDRLTGRHETG
SIDKFSWGVADRGGSIRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETLCGSD
Download sequence
Identical sequences TEQG_01107T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]