SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TEQG_06449T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_06449T0
Domain Number 1 Region: 118-482
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 8.44e-90
Family Glutamine synthetase catalytic domain 0.0000848
Further Details:      
 
Domain Number 2 Region: 21-111
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0000183
Family Glutamine synthetase, N-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TEQG_06449T0
Sequence length 484
Sequence
MAAETVTLDNLEEVLEDDCQVKVAGFDADGILRGKLVSKRKFLSIAQDGFGFCSVIFGWD
MHDQTYFKELGISNKENGYRDLVAVPDLSSFRRIPWERNVPFFLVSFLDPETKKAISACP
RGLLRAATAGLEEKGYRAMAGVEFEFYQYRAPPTVDSAERNSTGTARFLQYNPVNDLQPL
TEGMFGYSLTRTVHNQQYFYRIFDTCREFECDIESWHTESGPGVFEAALQFGEVKGMADR
GGLFKYVVKSVGSKFGITPVFMAKPRQGLPGNSGHMHVSLVDESGANLFVRDSPDPSPPY
PDLAYISDIGRHFLAGILAGLPDIMPILAPTINSYKRLVENFWAPVTVSWGLEHRAASIR
VISPPTCSGKGTRFEIRVPGADVNSHYVLAAIVALGWRGVRKKLDIPIPPLPKGEDVGGT
ADKGERLAKNLKEAVARFTAKESVAREALGDEFVDHFGGTREHEIRLWEEAVTDWEVKRY
IETV
Download sequence
Identical sequences F2Q067
TEQG_06449T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]