SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TEQG_00455T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_00455T0
Domain Number 1 Region: 3-372
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.27e-106
Family IF2B-like 0.000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TEQG_00455T0
Sequence length 385
Sequence
MSLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLS
IELTELMDHDKLSAEANEVEAFILEKLDYLVTSRPTAVNLSDAAIKLKALVQKRKQIGDP
KGKDLAEAYVEAAEKMLIDDAMDNHRLGDFGATWIMNNTPVGKDGKKVGVLTHCNTGSLA
TAGYGTALGVIRSLHASDKLEHAYCTETRPYNQGARLTAFELVHDKIPATLITDSMAASL
LAQKGTGLAAIVVGADRVVANGDTANKIGTYQLAVLAKYHGVKFIVAAPRTTIDLRTKEG
EDIIIEERAKSEVTRITGPRISDLGRNEENITLETVNIAAPGIDVWNPAFDVTPYDLIDA
IVTEVGVAEKNADGLFELEKLFGFQ
Download sequence
Identical sequences A0A059J736 F2PHN6
TEQG_00455T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]