SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TEQG_06481T0 from Trichophyton equinum CBS 127.97

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TEQG_06481T0
Domain Number 1 Region: 191-461,499-546
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.91e-83
Family IF2B-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TEQG_06481T0
Sequence length 553
Sequence
MATPQDQASAPAPPAAATQPGAQSTPPADTAPAKTPKPASAQKQAKEKPAAPDGTEKLSG
AELKKRAKAEKAARRAKEKQERPRPTNEDQEDDTAPYAASTGSTVSSATSTPQGPLTPKK
AASVKSDTSKSSSKSSITRHGSVHTLPTPPAPVESTSSKKKRREVVDEKVVAVFGHLPWY
TRRTGIAGANKDVHPAVLSLGMQIKDYVVCGSSARCVATLLAFKRVVQSYITPPGTSLTR
HLTTHLGHQIAFLASCRPLAISQGNAIRALKLIVSSIDPSVPEPDAKQEIYDFIDNFIRE
KITVAGQVIANSAAGKIDDGDVILCFSGSSVIQRTLLTAHKQGKKFRVSIIDTRPLFEGR
NLAQTLAKAGLRVQYSLINGISQAVKDATKVFLGAHAMTSNGGLFSRVGTALVAMSAKEK
SGGMNIPVIVCCETIKFTDRVALDSIVVNEIAEADELVAAEPCTTLTDLPPPVTNVKPET
SKGSSSSAIEIPAHLKNPKLPLENWREMPNLQLLNIMHDLTPAEYVDMVVTEMGSLPPSA
VPVVHRMSTENQS
Download sequence
Identical sequences TEQG_06481T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]