SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|OstRCC809_1|505|gw1.2.48.1 from Ostreococcus sp. RCC809

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|OstRCC809_1|505|gw1.2.48.1
Domain Number 1 Region: 537-695
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.69e-65
Family Polyphosphate kinase C-terminal domain 0.0000452
Further Details:      
 
Domain Number 2 Region: 355-535
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.22e-50
Family Polyphosphate kinase C-terminal domain 0.0000238
Further Details:      
 
Domain Number 3 Region: 141-321
Classification Level Classification E-value
Superfamily PHP14-like 9.42e-50
Family PPK middle domain-like 0.00047
Further Details:      
 
Domain Number 4 Region: 28-136
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 1.28e-28
Family PPK N-terminal domain-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|OstRCC809_1|505|gw1.2.48.1
Sequence length 695
Sequence
VTPPFAQEGMEEKKETLSEYDVETLVKSDTVFNAEMSWLAFNWRVLATAANEEVPIFERL
RFVAISARNLDEFFAKRVGAIKRQAAAGVENLVKRRGRDVWTPEETLQNVAVEVERQVDA
QAALLEDHIVPRLREEHDVSLEQYDDLDSELQRKLEKYFEAQIEPVLDPRAIDPCHPFPF
LGSLSLSIAVELEDAFKQDKFAIVSVPPSLERWIRIATEKNDPVQRFLPLEQLIEAHMEK
LFRGCNIRDTHVFRVTRNADIQRNEDEAEDLLEMMTDEVRERRFASFVRLEIQDTMPEYI
RDKLIASLDGITQTDVITVPHRAPLGFGTIDSVPVNFGMDIEMLYPPWSPRTHPRLEQVR
GREESIFSAITEGDIFVHHPYVSFATSTQAFIEQASRDPDVLSIKSTLYRTSDDSPIVKA
LIKAAENGKQVAVLVELKARFDEARNVNFAQRLETAGCNVAYGVKSVKTHSKASLVVRRE
GKKLVKYVHIGTGNYNPSTAGIYTDFGLLSRDEDLGDDVSNLFKFLMGHHYQERFKKLIV
APLRMRDEFVEMIEREAENALQGRPASIIAKMNGLDDAAICAALYRASQAGVKIQLIVRG
ICRIRPGIPGLSENIRVVSIIGRFLEHHRAFRFENDGNPEFYMGSADLMRRNLLRRVEVI
ARVYDPKIQQELQEVFDACLADQVLAWEMGSDGRY
Download sequence
Identical sequences jgi|OstRCC809_1|505|gw1.2.48.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]