SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|OstRCC809_1|91675|eugene1.0000030463 from Ostreococcus sp. RCC809

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|OstRCC809_1|91675|eugene1.0000030463
Domain Number 1 Region: 1894-2016
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000207
Family Filamin repeat (rod domain) 0.0045
Further Details:      
 
Domain Number 2 Region: 4468-4576
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000574
Family Filamin repeat (rod domain) 0.0052
Further Details:      
 
Domain Number 3 Region: 769-858
Classification Level Classification E-value
Superfamily E set domains 0.00000000000016
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 4 Region: 981-1080
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000000000000262
Family MgtE N-terminal domain-like 0.0073
Further Details:      
 
Domain Number 5 Region: 432-541
Classification Level Classification E-value
Superfamily E set domains 0.000000000000573
Family Filamin repeat (rod domain) 0.0073
Further Details:      
 
Domain Number 6 Region: 3087-3175
Classification Level Classification E-value
Superfamily E set domains 0.00000000000367
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 7 Region: 4700-4782
Classification Level Classification E-value
Superfamily E set domains 0.00000000000934
Family Filamin repeat (rod domain) 0.0041
Further Details:      
 
Domain Number 8 Region: 2130-2212
Classification Level Classification E-value
Superfamily E set domains 0.000000000024
Family Filamin repeat (rod domain) 0.0037
Further Details:      
 
Domain Number 9 Region: 887-977
Classification Level Classification E-value
Superfamily E set domains 0.0000000000294
Family Filamin repeat (rod domain) 0.0083
Further Details:      
 
Domain Number 10 Region: 1826-1925
Classification Level Classification E-value
Superfamily E set domains 0.000000000107
Family Filamin repeat (rod domain) 0.016
Further Details:      
 
Domain Number 11 Region: 3714-3816
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000000000144
Family MgtE N-terminal domain-like 0.01
Further Details:      
 
Domain Number 12 Region: 2539-2624
Classification Level Classification E-value
Superfamily E set domains 0.000000000274
Family Filamin repeat (rod domain) 0.0059
Further Details:      
 
Domain Number 13 Region: 258-336
Classification Level Classification E-value
Superfamily E set domains 0.00000000107
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 14 Region: 2757-2833
Classification Level Classification E-value
Superfamily E set domains 0.00000000153
Family Filamin repeat (rod domain) 0.0068
Further Details:      
 
Domain Number 15 Region: 549-654
Classification Level Classification E-value
Superfamily E set domains 0.00000000734
Family Filamin repeat (rod domain) 0.0076
Further Details:      
 
Domain Number 16 Region: 3377-3474
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000000296
Family MgtE N-terminal domain-like 0.009
Further Details:      
 
Domain Number 17 Region: 2017-2122
Classification Level Classification E-value
Superfamily E set domains 0.00000018
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Domain Number 18 Region: 4797-4900
Classification Level Classification E-value
Superfamily E set domains 0.000000394
Family Filamin repeat (rod domain) 0.021
Further Details:      
 
Domain Number 19 Region: 3191-3289
Classification Level Classification E-value
Superfamily E set domains 0.000000634
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Domain Number 20 Region: 2649-2744
Classification Level Classification E-value
Superfamily E set domains 0.00000167
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 21 Region: 1106-1191
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000301
Family MgtE N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 22 Region: 1693-1788
Classification Level Classification E-value
Superfamily E set domains 0.00000734
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 23 Region: 1595-1677
Classification Level Classification E-value
Superfamily E set domains 0.0000084
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 24 Region: 364-451
Classification Level Classification E-value
Superfamily E set domains 0.0000266
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Domain Number 25 Region: 4150-4247
Classification Level Classification E-value
Superfamily E set domains 0.0000274
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 26 Region: 3944-4033
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000798
Family MgtE N-terminal domain-like 0.0062
Further Details:      
 
Weak hits

Sequence:  jgi|OstRCC809_1|91675|eugene1.0000030463
Domain Number - Region: 4052-4129
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000127
Family MgtE N-terminal domain-like 0.0071
Further Details:      
 
Domain Number - Region: 2226-2315
Classification Level Classification E-value
Superfamily E set domains 0.000171
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Domain Number - Region: 3669-3731
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000209
Family MgtE N-terminal domain-like 0.02
Further Details:      
 
Domain Number - Region: 1476-1576
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000314
Family MgtE N-terminal domain-like 0.015
Further Details:      
 
Domain Number - Region: 4607-4693
Classification Level Classification E-value
Superfamily E set domains 0.000574
Family Filamin repeat (rod domain) 0.023
Further Details:      
 
Domain Number - Region: 1380-1509
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00392
Family MgtE N-terminal domain-like 0.01
Further Details:      
 
Domain Number - Region: 4404-4499
Classification Level Classification E-value
Superfamily E set domains 0.0105
Family Filamin repeat (rod domain) 0.033
Further Details:      
 
Domain Number - Region: 3487-3529
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0112
Family MgtE N-terminal domain-like 0.018
Further Details:      
 
Domain Number - Region: 4922-5017
Classification Level Classification E-value
Superfamily E set domains 0.0167
Family Filamin repeat (rod domain) 0.021
Further Details:      
 
Domain Number - Region: 2873-2939
Classification Level Classification E-value
Superfamily E set domains 0.0934
Family Filamin repeat (rod domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|OstRCC809_1|91675|eugene1.0000030463
Sequence length 5156
Sequence
MAEAKARFKTLRGWNADKYQFDVRAHSAYNVLPGTQRLKLIWKRGSKRAETGVAKVERGE
AVWDETLTLAGSMFVNPKTGMYERKPTLFVLQTMNEDGTPGTTYAEATLDLLEFALNPGR
ELSQTVPLRQGDVTMLTHLQFSLTATPLAENVAPSEVSSVLSAADLAEVATLAAASGAPE
RAATTTVIGDHEDEDYFDEGLPEKAKSDDEATSDKDEAFKYFDERLAYHIEDENEELPPP
TAEELLSGVDTEGGIVPGVKMMRLIVGKKCKIFVRGQDNFGNTRTTGGDNVEGVLVGPNG
QRGLVSTKDHGDGSYLLEFTCMQQGVWTLRTRFNGRLSMERHKLIVSFGPLMAQDVRIQM
PKPPFRCGAYTDLQVVVERPEDGRILTGAEAFNVRLISPAGLSIGVPLDIKPGTTAAIAR
INWPEVGDHKVDVRLDGESLRGSPMQVKVVPEELCLAACQLQGPGVHRSTAGIRSTFVIE
AHDNRGNRLLSGGAPLALLIRSSNNEEYRGEIVDFGNGTYEASYTVRVAGFYELSIAIFG
EELVVKGMCEPGKAVVAGCELVGDAGLDLEVGGSGRYSIIRHDAYGNRVPTRQGQVKFKV
VADGPGPSTCSIIDRADGVSDVDVTTSVAGRYYVQVTAGDQEPIPGSPFEVIAYPGPASN
NTSVTTVFGAQLASSDSDVLVAVAGEEVSLAVAPRDIYGNVTVFSKAAMITASATSAGVV
TAFEERTGTRQEVLLFATFRLAGSYLLHAKIGDKMLDGYPRILTVVSAATEPRKCILFGE
ALQGVRCNRITTLTMHASDKFGNLRSTGGDVVDVNLCSPDGTHVVAAKVDDHSDGTYGAK
FKLQRPGTWEIQLVVNGRGGRTQVNEVKSYFAGVKANECTFSGMGSDGIEGVVCFKSSSI
VIEPIDFEQNSRLMSGKEAVGVRILTPSGGISSVDLHFRDGRYHGSYTWTQPGQHTVSVS
LDQEAIVGSPFSVEAMSALPQIAELENMTIAEIAEMLPKLSNEGASQALQSLTPDKAAEV
LVGNTPESTVRMLSQVFPGDVAEILSCMPDDYAAAVLSCMPSERAAEVLGTMQAADTTKL
LLSMKVTEIGEKSEMFADVVCGMKKEDMLDTVRCFMNSKSEKALRSILDKMPARVVAEMT
TELNTDESSKILSGLSHERAAAVVSKLPEDQQVNVLGRLGGDSMFQMTKGLFAAYKIDKS
ASSQERNKTKAEAIDTGRRLAPALARMAESELCEIFKSASPEHISGVLFALVEDKRRSVH
SLAAARPVAQMLDSGTIEWGDGSTSVVDEAGTSILHSDGTVAELKEDGTIIDNDGQVLKL
RSDGIITADGTVLGEDGKITAGPSGAVHLYRSLEATQCPDTMIEVVNFCPPGTAGEILID
LTQTELRETLAPLSAAEQAKIIIEVGRLSPSQAARAVSILSHTEAASVVSILVNPGSSGR
CDEPFMGPFLELLSPQILRNVEPATAVGGALATHLSPTSAATVLHKLEPMDVSRIIEGMS
PAEVRQVLEASAALLAGNGKTVSDTPLVAALVPYVSGMDNSQAAALLESLPQDMAVGIMM
CTPEERANEIMEHTRRRDLKERVENKSLIHLDACTIVNLRGAVAGESSTFILEARERGGN
RIKFGGGHLTVSTKLWNAPGPGIEVGTVHDRGNGEYLVQFTSSLAGKIAVIVETAGQSRT
WDVNIEASDIVISKCTIEKNGLEGWTAGTPGKVLLTLRDRFGNFAHSTKSILEFEARASG
PGGVNVERNMLDDGRIEFVLNTTVTGIYKIAVSCLDTKEDLSGCPFEARMGTGTLSQAGC
TAMLQSLTSSTKGPGAKVAAFGACAAMAGEEVTCVVEARDRYGNNTTFAGENVAVVAYGP
AHLPAERPFEVADVRSGRMALRAIFPRSGSYTVSVTVDGIPIASSPLILHVFPGACETSR
AVLRGDALNGIVASKITSLLVQTEDKYGNHCHIGGDRVNLSMSGPNGIKVNALDVKDNED
GTYSFSFIVPQSGRWTIQAVVNGRVAKESTTEVVVTYGPLHAAACVLKGGPGMKRTEVCG
AQRDIYLQALEYDANGRGMSGQEAITMHMITPSGATHTLPAVFAERGSRYKATVRWWEVG
RHEIVAAVGGEPVVGSPFVVDVEAQEVSLPMCRLSGPGLQGAVAGERATILIESRDERGN
RLFNGGAQMGIAVRSGGETLRGKVQDCGDGTYEASYIVERAGPFELSLFLGTEAATYRAV
CKPGRVDYAKCQVDGVTNGVWIAGEQLTLTVTRMDRFGNRITRREGLAPFFGKAIGPGEV
TSQSVELGNGTAEIKLYGTVSGTYQLGVYVADTPIVPYANEEAAALMEGEQLMLEENKSE
HSSKKSANTKADSKLIGLRTDSLAGTVRSISRSDAGSGKAAIGVQPAVLIDGEDVEAMNE
IELPKITKMDGITMVPLPRGLFEMNLNPAVAMPNCCELEVIGGTRADNSWIAPAGDEVVV
RVIARDKYKNDTHWEEGQNITVEALGPEFLSFAAHGTTSLQNEFVAKMTRAGTFELRVLC
DALPVCWRAMQIIAGFTFPPRSILSMDGLKDVKTGDIVRLTLRTVDKYANLRLSGGDTVQ
VVLQGPNGALARQVSVTDHQDGTYALEFQVTAAGRWILNTRINSVLHTDGGISFVVAFGT
LTAEEAVLVFDPPLPANASVECGQASDLRVYGLGWETNNRVMTGLEAVSVRLTHPSGSQE
AVPVTLAQDNKCYSAKIRWLHPGVHSVNIMLDGVVVPGTPIRTNAEGKRLALISSALIGD
GATTCVAGEDAHFKLLARDYGGNTISKGGADVTIGCRAPGREPIEGVVVDNGDGTYNCTY
SSIIAGDVEVILTSTEGTNQTKRLLNVKCEAAECEIDECRVDAGKMMLLWNAGDAGLIRV
QRRDMYGNPTTKNTASGLNRFAAEVVGPGWADCEALELGDGSCELRLVAQAAGSYDISIV
ALAIDEDTMTPLDVPSVEVTSFSAIVSSQETFPSSCVARMALINAGGEETLADVDADITL
PSTIMAGDQIAMHVLARDLHGNTTNWLGGERIAVHARGPTEIPFIPSESVGSFTTSITAA
GAYSVAALVGDCACNRWPRILQVVAGPCNPDKCTVSGDALGTCTTATPISLLMQATDEYG
NPRSLGGDLIEAVLMNKDEGTINIRVVDNSDGTYTLNFELDMPIEHELWISANGIREKRS
RYSLLPSLGALQASDCVISGLSGERLLLADKSTLFVQPSNPSRVMSGREAVVVTVHLPSE
MSFNLPLKFDESTRRFTCPLLWVEVGDHHITVTLAGEVVPGCPFVVRVHDPDEEFGEIED
EPQESNAMSMVPADNSFGFVYTNDSKTIAAARETQEEQEETETEDAQDGEGEDDEVEEET
FIFGTALNPPPPQQVDSTVAIIRKLDLEDAGDALSDMRGEVAAAVLQRMNPQKAACAAAM
MSPSELGTAVTLMREESVVSMLVEAPPAARASIIESLPPEAAAQALNCMDPRTASLSLNK
LIDADVAAAILSKMKPSHAAQMLEFINADLQKQIFLELDPESMCSIITAAYDPVQPDSTR
RGIHLTPESVSIIFTTIAPEVCAKMIRNMQTDALGCELAAGAMQRATRTHPRAVENILAM
TQMTATDGGAAIKAAVLRQPGGDEIVANAESSIRKGEIEIPAPVVKTKTPKFRWGGTGLK
PSKTASERAARSLSGMAPKVSAQALADMRPGAAGAVLAAMDSEHVSSIISVMGADVLANA
IGSMDAEDALRVIVGSSPSVRVTIVESLPVGAQGSILSMLPAEEAADLLRAMDSSAALDA
VHAMSARAAAIVLQELPEEQMSNYLLALPPSTASPILAKMCATEPGLKSASHALKILSET
NPDKATSHLSGMLQRDAKSTAQVFSSFIVHSQGKVLSSFNAKDAGKMLQFLGPQNAAQAL
IEAVDGGTNAAVAAVALEALARLGVWPPSVDVPRFGVKVRGPLADVLLVMFELNPEHSAL
VLTALDPQVSASAIGAMSPATAGTLASAIPDPKIAALLLESMPHAKRAAMIIKMRPQPAA
DAASNMSVEHVVAIITTLYETQDPATMVIANDIISKMDSFKAGSVIVMLKEDFAVRILSA
LPPLVAADMISSGGLPSDKAGELLDRVKLDQAENVLSALPPSLAEEAVEKVSSTELKAKT
ASRTVVHLTSSLVSGPGCEECVAGLETKFIFESANPGGVRIHKGGASLHCDIYHLTFKAK
DNSNEVEYIRGQAQEVNVQDMMNGSYEFTYKVDKAGEYDAVITSAGQTRTVRIKCKPAVL
DPTQCAVAPLDENTRWRAGDVLVAKVLCRDRFGNDVAPPKSGDAAVDFVLLADGEGPSVV
EAEIVDDPSGVGALAKFRATESGKYTLRVFTADVTRQWWGGVQRECIQGAPIELVLEAST
ADASRSSVQLSGIRERGGSMLLGLAGRQMAVVVFARDRFNNEAVFDKERLRVDAVGVTNS
VFALSSKEAGEVMFTNALQRAGTYSLRVTVEGKAVHGFPRNLQVVAAQTDPRFCSIRGDA
LNRVIAGEVTKVLVNASDRYQNVCLEGGDRLTARLLGPAGSIDADTSDFGDGTYRLSFVV
PRAGEWKVFLAVNGVENPKPATTFIAGQGGLTSKQLMLIPADKRDEFIVGSESIFYIQSL
DYEIGGLEVNGHEAVCLRLITPSGLSTIVPLRLTKDKARYQAVVVWPEVGAHSLVAALNG
EVIVGCPYSVQAAAAQVSLPGCKITGTGSTKAVAGERATFNIEARDARGNRMMCGGASIS
AVIQSSMTPGRSIKGSILDQGDGTYVCSYTINMAGPFTITVSSPSSTASLSATCVPGPAD
PAYCRIDASQVRRIEAGASGVVKVLRADRFDNLIPAGADLMPFRVEATGVGPADVETVEA
GNGSAEIRFEARAVGRYTLYVWSGFKREPVLGSPCEIQVLPSQPAAAACKALLEGAEYKA
QGVYSAQAGAVVTVRMQPRDRFGNSTGWKEWQTLTVTASGAEDIVFDEIDDDHTSSRGVF
RTTFAKAGAYVIWVTVGGQTIVGWPRVLQIIPGTTNANVSSLRPESDTMALATELVRHGG
NDSSLIDALGRQSVDVDKLRGEMIVLREKLASYERAEHATGQHAIIDPNAEALTTQQVQK
QNDKTLRLMVNETDSEANTMASEEDFVEATDADLFPDELDDPAAAEDEFTDAKAAP
Download sequence
Identical sequences jgi|OstRCC809_1|91675|eugene1.0000030463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]