SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|OstRCC809_1|49397|estExt_Genewise1Plus.C_190111 from Ostreococcus sp. RCC809

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|OstRCC809_1|49397|estExt_Genewise1Plus.C_190111
Domain Number 1 Region: 75-149
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.84e-29
Family Skp1 dimerisation domain-like 0.0000324
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily POZ domain 1.18e-20
Family BTB/POZ domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|OstRCC809_1|49397|estExt_Genewise1Plus.C_190111
Sequence length 151
Sequence
MANTITLRSSDGETFEVEEDVAFLSETIRSIIEDTENDAPVPLPNVSSKILAKVIEYCKY
HVAAKKENESEQKVKEFNSAFVKVDQATLFEIILAANYLNMSGLLDLTCMTVANMMKGKT
PEEIRKTFNIKNDFTPEEEEEVRKENQWAFD
Download sequence
Identical sequences jgi|OstRCC809_1|49397|estExt_Genewise1Plus.C_190111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]