SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386867576|ref|YP_006280570.1| from Bifidobacterium animalis subsp. animalis ATCC 25527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386867576|ref|YP_006280570.1|
Domain Number 1 Region: 201-359
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.08e-40
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 20-192
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.09e-40
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000553
Further Details:      
 
Domain Number 3 Region: 376-553
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.78e-37
Family Pyruvate oxidase and decarboxylase PP module 0.00000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386867576|ref|YP_006280570.1|
Sequence length 590
Comment oxalyl-CoA decarboxylase [Bifidobacterium animalis subsp. animalis ATCC 25527]
Sequence
MVDVTATATSSDQNLTDSPHYLAETLIKNGVKHMYGVVGIPVTDFARIAQGMGIRFIGMR
HEEDAVNAAAAEGFLTGRPAVALTVSAPGFLNGLAPLLEATTNGFPVIMIGGSSTRHVVD
MHEGEYEGLDQMNYAKQFCKESFRIDKIEDIPLAVARAMHIACSGRPGGVYIDFPDDAVA
QTLDKDVAESQLWVANQPTPAMPPAQSSVDEALKLLSEAKNPLMLVGKGAALAQAEDELR
EFVEKTDMPFQPMSMAKGVIPDDDPHCTASCRGLALRTADVVLLVGARLNWMLNFGEGKE
WNPNVKFIQIDIDPNEIENARSIACPVVGDIKSAMQMINAGLEKTPVKASAQWLDMLKAD
AEKNDAKFAARVNSNTVPMGHYDALGAIKKVYDQHKDMILTNEGANTLDDCRNIIDIYQP
RHRLDCGTWGVMGCAVGYSIGAAVATGKPVLYVGGDSGFGFDGMEVEVACRYNLPITFVV
LNNGGIYRGDFENLGDDGDPSPLTLSYDAHYERMIEAFGGNGYYATTPAEVEQMVSEAVA
SGKPSLVHVQLADYAGKESGHISNLNPKPVVGPLATSEMTKNPYLKGAHM
Download sequence
Identical sequences WP_014698219.1.27023 WP_014698219.1.27029 WP_014698219.1.42329 WP_014698219.1.75953 gi|386867576|ref|YP_006280570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]