SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SOCG_02950T0 from Schizosaccharomyces octosporus yFS286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SOCG_02950T0
Domain Number 1 Region: 141-466
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.37e-83
Family IF2B-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SOCG_02950T0
Sequence length 472
Comment | SOCG_02950 | Schizosaccharomyces octosporus yFS286 ultracontig translation initiation factor eIF-2B subunit delta (473 aa)
Sequence
MAVPTEQERELSNEPVAIKEINTGAAGIETNTQTVNTGAEPKKSGKDLKALKKAQKQASR
KARADQQGGGKEKGNGSDERKQDQNSKGGNQLKKPSKQNGKGSPPVPKKEDPAVLEQMFF
EEKQVSIFSHLDWRRRRTTENLPKDIHPAVIRLGLKLANYKVFGSNQRCIELLKTFKKVI
RDYQTPFGTTLSRHLTTHVNSQIAYLVSTRPLSISMGSAIRFLKLEISVLDIDLTEEEGK
ELLLEKIDNFIRDRIVIAGKAIVQAAAEKIQDGDIILTYLHSSTVNDVLVHAKNIGKQFR
VIVVDSRPEFEGRTCLKLLTSHGILCTYVMISALAYTMQEVTKIFLGGHAMLSNGALYSR
AGTSLIALLGKEANVPVIACCESYKFTERIQLDSLVYNELAPGDQLINTSVDENQEKRSE
LSDWHSVKNLKLLSLKYDVTPPRLITVCVCEMGLLPSTSVPAIINEFKQVYA
Download sequence
Identical sequences S9Q0K6
SOCG_02950T0 XP_013016894.1.790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]