SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Asptu1|137067|e_gw1.14.184.1 from Aspergillus tubingensis v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Asptu1|137067|e_gw1.14.184.1
Domain Number 1 Region: 218-536
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.12e-57
Family beta-Lactamase/D-ala carboxypeptidase 0.000000252
Further Details:      
 
Domain Number 2 Region: 645-744
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 7.59e-44
Family D-aminopeptidase, middle and C-terminal domains 0.0000897
Further Details:      
 
Domain Number 3 Region: 566-639
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.000000863
Family D-aminopeptidase, middle and C-terminal domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Asptu1|137067|e_gw1.14.184.1
Sequence length 750
Sequence
MSTEPLLPSYASATQHDATPHVRRHSARRRTSLIIPAAPVIQTLSGLTFMTTAIISTVWA
YRSYVPPPELSPAEPPSLLPYFASLCLTISLGFWVGYLLFILYDGAGGPRMQRKVVIGAS
TVGKLVLAGAHIGVWLGYKYLLTGSKQPSWALMFLATQACYAGLGKGAVRPEPGASQTGA
RYPSGPSFKKQALDLNNYLYGYCFADPKLRVTSPNMQAILETIPSRYRGPGGAVAIIKDG
ELAGKYTWGYADLRKRIPMTASTLMPICSITKQMLCLILKDLERNPTPAMVERGDIPQQL
SDAFRQLVSPELIDNNGLRIDHLCNNQSGIRDYWAMSMFWGTQPEGQFTLADDAKKALDR
TKSLHFQPGTQFSYCNFNFHILARIVEHVSGTSLGALLSERLFLPAGMKTATLCADNAKL
PPPCVGYEGNESFGYIPAVNQTQWSGDAGVVASLEDMIAYECYLDKAWADRESVYREIAK
EPLFDNGTPAGYGYGLEHIKFGQTATIGHGGAIRGYRLHRTQVLTERFAVVAMLNHEIDA
AEVAGHIFQQALGLPAQHGLLSMPAPNWAGVYFDPEAQLVVEVRLGGPGEVIVTYTGDDE
TLKLTEEFEARSDLATATLCSDILILHRKYDNRHIQAKRIIAGQQPPKGDYVGRYHCAEM
DSIFLCSGAGGMLYGSFKGFLGHGPAELMRYLGDDIWFLVCARGLDAPAPGNWTVVFQRD
VQGKVVGVTFGCWLARKITFVKDRTPQILD
Download sequence
Identical sequences A0A1L9NF42
jgi|Asptu1|137067|e_gw1.14.184.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]