SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Asptu1|194426|gm1.8617_g from Aspergillus tubingensis v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Asptu1|194426|gm1.8617_g
Domain Number 1 Region: 563-594,632-666
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000392
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Asptu1|194426|gm1.8617_g
Sequence length 809
Sequence
MTTKVGHLLAKVLGIDLASNTDPYLRDGSDTAGHYVETEPTAGEWLRELVPSRRQIGRYF
YDLFPFLHWIMSYNLQWFIGDLIAGVTVGAVVIPQGMAYAILAKLPAEYGLYSSFMGVLI
YWFFATSKDITIGPVAVMSTLVGTIIIEVQKDYPDVDGPTIAGALAIICGAIVTFIGLFR
LGFIVDFIPLPAITAFMTGSAINVCVGQVKTVLGETADFSTRGSTYMVIINTLKYLPTSQ
MDAAMGLTALAMLYAIRAACNYGTRKYPRKAKLFFFLNTLRTVFVILFYTMISAAVNLHR
RNNPAFKMLGKVPYGFQHAGVPKINVDIIKTFAKELPAAVIVLVIEHIAISKSFGRVNNY
TINPSQEFIAIGISNLLGPFLGGYPATGSFSRTAIKAKSGVRTPLAGVITAIVVLLAIYA
LPALFFFIPSSSLSAVIIHAVGDLITPPKVIYQFWRVSPLDAVIALVGIIVIIFSSIEDG
IYCTICISVAVLLFRIAKARGQFLGQVQIHSVIGDHLVEDTGSAKEFNSAAQLSASDYKH
TSSRTVFLPLKHTDGSNPTIPITQPAPGIFIYRVSEGFNYPNANHYTDNLVEHIFESTRR
TNPSLYATPGDRPWNDPAPRKSKAEQIANSTEKPLLRAVILDFSAVNNVDVTSVQNLIDV
RSQLDRYAAPDRVQWHFAHINNRWTKRALAAAGFGRPSDVPELKPIFNITEAVYSGDSSD
QRASDIESQAGDQLKQSKSRDDKNAGVLSIREMDEAAKGSERTAVQRRGDSKPAVVTGVN
LPLFHIDLKSALECVMASVSDTPGKVHAS
Download sequence
Identical sequences A0A1L9MRF4
jgi|Asptu1|194426|gm1.8617_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]