SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Asptu1|28021|fgenesh1_pg.2_#_970 from Aspergillus tubingensis v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Asptu1|28021|fgenesh1_pg.2_#_970
Domain Number 1 Region: 579-607,642-676
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000667
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Asptu1|28021|fgenesh1_pg.2_#_970
Sequence length 841
Sequence
MSQDLMTKTGHGLAKVLGIKLPYRDPLGAHSDPVTRGESTFSYGTVETYSYLEPEPTTAE
WLKEICPTWHDVLMYFYNLFPFLSWITKYNLQWFFGDLVAGVTVGAVVVPQGMAYAKLAE
LPVQYGLYSSFMGVLVYWFFATSKDITIGPVAVMSTLVGTIVLQAEQEIPDVPGHIVASC
LAIICGAIVCALGLLRLGFIVDFIPLPAISAFMTGSALNIAAGQVKKLLGESADFSTRGS
TYMIIINSLKYLPTAGIDAALGVTALAMLYIIRSVCNYGARKYPRQAKVWFFASTLRTVF
VILFYTMISAAVNLHRKDNPMFDLLGSVPRGFQDAAVPVVNARIIKVFASQLPACVIVLL
IEHIAISKSFGRVNNYTIEPSQELVGIGVTNLLGPFLGAYPATGSFSRTAIKSKAGVRTP
LAGCITAIVVLLAIYALTAVFFYIPQAALSGVIIHAVGDLITPPNTVYQFWRVSPLDAII
FFIGVIVTVFTSIEDGIYCTICVSVAVLLFRVAKARGQFLGRVTIHSVVGDHLIQGDGKY
GPGGFPDAPDNEGESRRSIFLPLNHTDGSNPEVEVEQPYPGIFIYRFSEGFNYPNANHYT
DYLVQAIFRQTRRTNPFSYARPGDRPWNDPGSRKGKEESRSQRPILRSIILDFSSVNNVD
VTSIQNLIDVRNQLDLYASPRTVQWHFAHINNRWTKRALAAAGFGYPTPASDDGFHRWKP
IFSVAEIEGRASAAAHAEMVNNEHAHQNAVKRDLEEGLKHETHMTEREASGIDIEASSDN
SSTPDDKLARDLKDSKAYRNRRKAAVVQGINRPFFHIDLTSALESALANSPPEEPIEEPS
A
Download sequence
Identical sequences A0A117DWF7 A0A1L9NCN3
jgi|Asptu1|28021|fgenesh1_pg.2_#_970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]