SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Asptu1|31342|fgenesh1_pg.5_#_799 from Aspergillus tubingensis v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Asptu1|31342|fgenesh1_pg.5_#_799
Domain Number 1 Region: 171-390
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.64e-89
Family ATP sulfurylase catalytic domain 0.00000000183
Further Details:      
 
Domain Number 2 Region: 4-170
Classification Level Classification E-value
Superfamily PUA domain-like 1.19e-54
Family ATP sulfurylase N-terminal domain 0.0000000574
Further Details:      
 
Domain Number 3 Region: 391-503,540-572
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.71e-38
Family ATP sulfurylase C-terminal domain 0.0000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Asptu1|31342|fgenesh1_pg.5_#_799
Sequence length 574
Sequence
MANSPHGGVLKDLLARDAPRHDQLAAEAETLPALTLTERQLCDLELIMNGGFSPLEGFMN
QKDFDGVCENCRLADGNVFSMPITLDASQKTIDELKLQAGARLTLRDFRDDRNLAILTID
DIYRADKQKEAKLVFGGDPEHPAIKYLNNTVQEFYIGGKIEAVNKLNHYDYVALRYTPAE
LRVHFDKLGWSRVVAFQTRNPMHRAHRELTVRAARARQANVLIHPVVGLTKPGDIDHFTR
VRAYQALLPRYPNGMAVLGLLGLAMRMGGPREAIWHAIIRKNHGATHFIVGRDHAGPGKN
SKGEEFYGPYDAQHAVEKYKDELGIEVVEFQQVTYLPDTDEYRPKDEVPAGVKTLDISGT
ELRKRLRTGAHIPEWFSYPEVVKILRESNPPRASQGFTIFLTGYMNSGKDAIARALQVTL
NQQGGRSVTLLLGDTVRHELSSELGFSREDRHTNIQRIAFVAGELTRAGAAVIAAPIAPY
EESRKAAREAVAGSGGNFFLVHVATPLEHCEKTDKRGIYAKARRGEIKGFTGVDDPYEAP
ANADLTVDVSKQSVRSIVHEIILMLESEGYFDRN
Download sequence
Identical sequences A0A100INX9 A0A1L9N202 B4FBM1
jgi|Asptu1|31342|fgenesh1_pg.5_#_799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]