SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|469820843|ref|YP_007595213.1| from Acinetobacter baumannii D1279779

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|469820843|ref|YP_007595213.1|
Domain Number 1 Region: 14-403
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 7.06e-140
Family ArgJ-like 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|469820843|ref|YP_007595213.1|
Sequence length 406
Comment glutamate N-acetyltransferase/N-acetylglutamate synthase [Acinetobacter baumannii D1279779]
Sequence
MAVGDVTMPQMHVVKGVKIGSTEAYVRYPNRRDLVIFEFAEGSNVAGVFTQNAFCAAPVH
VSKAHLAEGNPRYLVINTGNANAGTGPTGLKNAQDTCAKLAELAGVNSFEVLPFSTGVIG
EQLPMERLLAGLQPALNSVQDAAWSDAASGIMTTDTVPKGASEQFELDGMTYTMTGISKG
AGMIRPNMATMLSFVATDAPIRRDLVQKLLKTTVEHSFNRITIDGDTSTNDSCIFVATGQ
AGGAEITSESDARYAKVLEVLARVMNRLAQLIVRDGEGATKFITVAVEGGANTQECCDIA
YSIAHSPLVKTALFASDPNWGRILAAIGYAGVKDLDVSKIQVWLDDVQICKDGGAAEDYT
EEAGARVMAQTEITIRVDLGRGQAKDTVYTCDLSYDYVKINADYRS
Download sequence
Identical sequences A0A009R8E8 A0A062DLU3 A0A062FCL8
gi|469820843|ref|YP_007595213.1| WP_000268128.1.12837 WP_000268128.1.20743 WP_000268128.1.22104 WP_000268128.1.22216 WP_000268128.1.27531 WP_000268128.1.34577 WP_000268128.1.34986 WP_000268128.1.35436 WP_000268128.1.37007 WP_000268128.1.37212 WP_000268128.1.37695 WP_000268128.1.40431 WP_000268128.1.43380 WP_000268128.1.4426 WP_000268128.1.44538 WP_000268128.1.46209 WP_000268128.1.47475 WP_000268128.1.52644 WP_000268128.1.60371 WP_000268128.1.6519 WP_000268128.1.69046 WP_000268128.1.69458 WP_000268128.1.70739 WP_000268128.1.73820 WP_000268128.1.76216 WP_000268128.1.78988 WP_000268128.1.79242 WP_000268128.1.80769 WP_000268128.1.85101 WP_000268128.1.87156 WP_000268128.1.87717 WP_000268128.1.9 WP_000268128.1.90593 WP_000268128.1.91299 WP_000268128.1.9154 WP_000268128.1.92513 WP_000268128.1.95118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]