SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|469821888|ref|YP_007596258.1| from Acinetobacter baumannii D1279779

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|469821888|ref|YP_007596258.1|
Domain Number 1 Region: 57-336
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.53e-39
Family Phosphate binding protein-like 0.027
Further Details:      
 
Domain Number 2 Region: 383-472
Classification Level Classification E-value
Superfamily NosL/MerB-like 0.000000000732
Family NosL-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|469821888|ref|YP_007596258.1|
Sequence length 476
Comment ABC transporter substrate-binding protein [Acinetobacter baumannii D1279779]
Sequence
MRQNKLINKKLLLSSLIGAIVLGTLGCGSKTETVRVAIGTQDTTINCATGGLLIRELNLL
PKYLPKNGEYKHVKYDIQWKNFTSGAPLTSEMVAGRLDLGAMADFPAVNNLAAFKKAGKE
SIFLAPLSGSINGSGNAIVVPIDSKVTSLKELKGQTISVPFASTAHGLLLRAIQAEGWQL
DKDIKVIAQAPEVAGPALKSHKIAAHADFVPFGELFAYQGFAKKIYDGSQAKSPTFHGSL
ASKDYAQQHPEVIKAYLQATIEANRLIREQPEKYSELIAEKTGIPAEVVYLFHGPLGLQT
RDLTWKPEYRKATQIAIDTLKVLGKNDGTLDVNKFIDDQYIKDAFQASGLNYSQQLSDYA
KSPLVANDALTGQPIKTFDRVTQIWVKGEEKVRSYETPEHAFSDLKKIQADGKTVRVVYS
QDHQSDIKLLANLAWYATDKAGQIQAFLLKDDAEKWAKQQGGKVYDFKAIQLVTQS
Download sequence
Identical sequences gi|469821888|ref|YP_007596258.1| WP_001249626.1.12837 WP_001249626.1.22216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]