SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000135 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000135
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.4e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.000000378
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.06e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000208
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.14e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000135   Gene: ENSOGAG00000000153   Transcript: ENSOGAT00000000153
Sequence length 390
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:27260693:27266441:1 gene:ENSOGAG00000000153 transcript:ENSOGAT00000000153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPEVHLASHFVNEACGGLVFGGCVEKSPISRNPEVPFESTAYCISASARGKELRLTL
SPLPGAQPPQEPLALVFRFGMSGSFQLVPGDALPPHAHLRFYTAPPGPRLALCFVDIRRF
GRWDLGGEWQLDRGPCVLLEYEQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILFRLRIPPFEKARTVLEALQQRRLSPELTLSQKIRAKLQNPDLLELCHSVPKEVVQLG
GKGYGPESGEEDFAAFRAWLQCYGVPGMSSLRDRHGRTIWFQGDPGPLAPKGCKSRQKKS
KATQLSPEDRVEDPPPPRRTSARIQKTQRDLPEKTTTQQPEGSSLQQDPGAFTVPNKGRK
KRRQATTGHRRLQKIKGDTPSSEPEGTSAS
Download sequence
Identical sequences H0WFV0
ENSOGAP00000000135 XP_003784577.1.62490 ENSOGAP00000000135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]