SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000175 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000175
Domain Number 1 Region: 3-157
Classification Level Classification E-value
Superfamily E set domains 2.94e-18
Family Arrestin/Vps26-like 0.029
Further Details:      
 
Domain Number 2 Region: 159-301
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000483
Family Arrestin/Vps26-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000175   Gene: ENSOGAG00000000199   Transcript: ENSOGAT00000000199
Sequence length 391
Comment pep:known_by_projection scaffold:OtoGar3:GL873592.1:75901:78330:1 gene:ENSOGAG00000000199 transcript:ENSOGAT00000000199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMFKKIKTFEVIFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGS
QQCKQTLEYLRYEDTLLLDDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGC
VDYWVKAFLDRPSQPTQEIKKSFEVMDLVDVTTPDLMAPVSAKKEKKVSCMFIPDGRVSV
SARIDRKGFCEGDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGN
HIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRS
GLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDIIPEDHRLESPTTPLLDDMDGSQD
SPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ
Download sequence
Identical sequences H0WFX8
XP_012663113.1.62490 ENSOGAP00000000175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]