SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000000283 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000000283
Domain Number 1 Region: 377-510
Classification Level Classification E-value
Superfamily C-type lectin-like 7.09e-42
Family C-type lectin domain 0.0000883
Further Details:      
 
Domain Number 2 Region: 235-368
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 521-656
Classification Level Classification E-value
Superfamily C-type lectin-like 2.23e-34
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 4 Region: 969-1119
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-33
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 5 Region: 830-956
Classification Level Classification E-value
Superfamily C-type lectin-like 8.61e-33
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 6 Region: 664-814
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-28
Family C-type lectin domain 0.00054
Further Details:      
 
Domain Number 7 Region: 1262-1399
Classification Level Classification E-value
Superfamily C-type lectin-like 3.26e-27
Family C-type lectin domain 0.0025
Further Details:      
 
Domain Number 8 Region: 1126-1250
Classification Level Classification E-value
Superfamily C-type lectin-like 1.19e-26
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 9 Region: 41-172
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.68e-25
Family Cysteine rich domain 0.0029
Further Details:      
 
Domain Number 10 Region: 172-230
Classification Level Classification E-value
Superfamily Kringle-like 2.28e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000000283   Gene: ENSOGAG00000000316   Transcript: ENSOGAT00000000317
Sequence length 1483
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:16986739:17042733:-1 gene:ENSOGAG00000000316 transcript:ENSOGAT00000000317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGRSVPAPWPHHLLRCALLLWGLHLGRPGAPGDAALPEPNVFLIFSQGLQGCLEAQGG
QVRVTPACNASLPAQRWKWVSRNRLFNLGSMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGGRTSNISKPGTLERGDQTRGGQWRIYGSEEDLCARPYYEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAEPAPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLLSI
HSMAELEFITKQIKQASPEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDS
LEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGE
DQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYSWEGEHFWTALQDLNGTGSFRWLS
GDEVTYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELP
GPDPTPSLTGSCPQGWASDPKLRHCYKVFSSDRLQDKKSWIQAQGACQEVGAKLLSLASY
EEEHFVADMLNKIFGESEPEIHEQHWFWIGLNRRDPGGGQSWRWSDGLGFSYHNFDRSRH
DDDDIRSCAVLDLASLQWVAMQCETQLDWICKIPRGAEVWEPDDSPQGGQEWLRFQDAEY
KFFEHHSTWAQAQRICTWFQAELTSVHSQTELDFLGHNLQKFSRGQEQHWWIGLHTSEMD
GRFRWTDGSVINFISWAPGKPRPIGKDRKCVYMTASREDWGDQKCLTALPYICKRSNSTG
ETQPPDLPPKALGGCPSGWNQFLNKCFQIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANP
LEQAFITASLPNVTFDLWIGLHAAQRDFQWVEQEPLLYTNWAPGEPSGPSPAPSGNKPTS
CAVVLHSPSAHFTGRWDDRSCTEETHGFICQKSTDTSLSPSPAASLPAPGSELSYLNSTF
RLLQKPLRWHDALLLCESRNATLARVPGPYTQAFLTQAARGLRIPLWIGLTSEEGTRQYS
WVSEEPLSYVNWQDGEPQQAGGCAYVDVDGTWRTTSCDTKLQGAVCGVHGGPPPSRKISY
HGSCPQTLADSAWIPFREHCYSFHMELLMGHKEALQRCQRVGGAVLSILDEMENVFVWEH
LQNYEGQSRGAWLGMNFNPKGGTLVWHDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSG
LWRPGACTNITMGVVCKLPRGEQSGSSPSAALPENPAALIVVLMAVLLLLALLTAALILY
RRRQSMEQGAFEGARYSRSSSGPGEATEKNILVSDMEMNEQQD
Download sequence
Identical sequences H0WG64
ENSOGAP00000000283 ENSOGAP00000000283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]